PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof005766
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family HSF
Protein Properties Length: 94aa    MW: 10020.3 Da    PI: 3.8571
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Sof#S17323392PU_refUnigeneView CDS
PUT-157a-Saccharum_officinarum-78539PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind30.59.4e-105288238
                  HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHH CS
  HSF_DNA-bind  2 Flkklyeiledeelkeliswsengnsfvvldeeefak 38
                  Fl+k+y++++d++++  +sw++++nsfvv+d++ f +
     Sof005766 52 FLTKTYDMVDDPSTNPDVSWNATNNSFVVWDPHAFFT 88
                  9********************999**********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.109.3E-114692IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467852.04E-94991IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004476.1E-75290IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 94 aa     Download sequence    Send to blast
MDPMVNPVKE ESHGEGGDLL AGTEEAGDGP SSAVAAAPRP MEGLHEPXPX PFLTKTYDMV  60
DDPSTNPDVS WNATNNSFVV WDPHAFFTVL VPGX
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.98561e-153inflorescence| meristem| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002459419.12e-49hypothetical protein SORBIDRAFT_02g004370
SwissprotQ6VBB21e-29HFA2B_ORYSJ; Heat stress transcription factor A-2b
TrEMBLC5XB032e-49C5XB03_SORBI; Putative uncharacterized protein Sb02g004370
STRINGSb02g004370.16e-49(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22830.12e-22heat shock transcription factor A6B